PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna05018.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 341aa    MW: 38151.9 Da    PI: 6.4361
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna05018.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.4e-183178148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT eEd+ l ++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  mrna05018.1-v1.0-hybrid 31 RGPWTVEEDLALMNYIANHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 78
                             89********************************************97 PP

2Myb_DNA-binding51.23e-1684127146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  mrna05018.1-v1.0-hybrid  84 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 127
                              7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.762682IPR017930Myb domain
SuperFamilySSF466894.87E-3128125IPR009057Homeodomain-like
SMARTSM007171.8E-143080IPR001005SANT/Myb domain
PfamPF002493.1E-163178IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-233285IPR009057Homeodomain-like
CDDcd001671.06E-113378No hitNo description
SMARTSM007171.3E-1483131IPR001005SANT/Myb domain
PROSITE profilePS5129418.70783133IPR017930Myb domain
PfamPF002495.9E-1584127IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-2386132IPR009057Homeodomain-like
CDDcd001671.24E-7104127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009620Biological Processresponse to fungus
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MDVKPGRVSD TTRNSSHHEE DEDAMMMDLR RGPWTVEEDL ALMNYIANHG EGRWNSLARC  60
AGLKRTGKSC RLRWLNYLRP DVRRGNITLE EQLLILELHS RWGNRWSKIA QHLPGRTDNE  120
IKNYWRTRVQ KHAKQLKCDV NSKQFKDTMR YLWMPRLVER IQAAASSATA TTGASSSITN  180
SAANAYHFNN NNGFQPVALQ QATVIGSNND LAGSYTTPDN SSTAASSDSF GTQVSPVSEL  240
TDYYSNMSVN NNDVPSSQAT LDYFQATNPH HQVGYHDSMT SPSGYSFNQG GLNSHSFQAA  300
SAPEQNNNGQ WGMDGGDFSD NLWNVEESDM WFLQQQLGNI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-242812524120MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00334DAPTransfer from AT3G06490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285400.0FR828540.1 Rosa rugosa mRNA for putative MYB transcription factor (myb7 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004295042.10.0PREDICTED: transcription factor MYB108
SwissprotQ9LDE12e-91MY108_ARATH; Transcription factor MYB108
TrEMBLF2QKW00.0F2QKW0_R
STRINGPOPTR_0008s10080.11e-134(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.12e-90myb domain protein 108